Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E8 (SPD8)

This Recombinant Human Speedy protein E8 (SPD8) spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E8 SPDYE8

UniProt

P0DUD1

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Spef2 shRNA (UAS) - Lentiviral mouse Spef2 shRNA (UAS, RFP) (25)
GTR15249731 1 Vial

Lentiviral mouse Spef2 shRNA (UAS) - Lentiviral mouse Spef2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TSC22D4 (TSC22 Domain Family, Member 4, THG-1, THG1) (MaxLight 490)
MBS6209167-01 0.1 mL

TSC22D4 (TSC22 Domain Family, Member 4, THG-1, THG1) (MaxLight 490)

Sign In for Pricing
View Details
TSC22D4 (TSC22 Domain Family, Member 4, THG-1, THG1) (MaxLight 490)
MBS6209167-02 5x 0.1 mL

TSC22D4 (TSC22 Domain Family, Member 4, THG-1, THG1) (MaxLight 490)

Sign In for Pricing
View Details
5- (Piperidin-4-yl) pyrimidine
IEB73849-01 50 mg

5- (Piperidin-4-yl) pyrimidine

Sign In for Pricing
View Details
5- (Piperidin-4-yl) pyrimidine
IEB73849-02 0.5 g

5- (Piperidin-4-yl) pyrimidine

Sign In for Pricing
View Details
Inca1 3'UTR Luciferase Stable Cell Line
TU110113 1.0 mL

Inca1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details