Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E17 (SPD17)

This Recombinant Human Speedy protein E17 (SPD17) spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E17 SPDYE17

UniProt

P0DUD2

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm12169 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3198205 3x 1.0 µg

Gm12169 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
1-[3- (Trifluoromethyl) phenyl]piperazine, dihydrochloride
BDA83514 100 mg

1-[3- (Trifluoromethyl) phenyl]piperazine, dihydrochloride

Sign In for Pricing
View Details
AffiniPure Goat Anti-rabbit IgG (H+L) secondary antibody, DyLight®550 Conjugated
BA1135-0.5ml 0.5 mL

AffiniPure Goat Anti-rabbit IgG (H+L) secondary antibody, DyLight®550 Conjugated

Sign In for Pricing
View Details
Monkey Actin-related protein 8 (ACTR8) ELISA Kit
MBS7207857-01 48 Well

Monkey Actin-related protein 8 (ACTR8) ELISA Kit

Sign In for Pricing
View Details
Monkey Actin-related protein 8 (ACTR8) ELISA Kit
MBS7207857-02 96 Well

Monkey Actin-related protein 8 (ACTR8) ELISA Kit

Sign In for Pricing
View Details
Monkey Actin-related protein 8 (ACTR8) ELISA Kit
MBS7207857-03 5x 96 Well

Monkey Actin-related protein 8 (ACTR8) ELISA Kit

Sign In for Pricing
View Details