Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C)

This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Allograft inflammatory factor 1 like (AIF1L) ELISA kit
GTR10465665 96 Well

Sheep Allograft inflammatory factor 1 like (AIF1L) ELISA kit

Sign In for Pricing
View Details
Ethyl (E) -3- (p-Tolyl) acrylate
OR1078691-01 250 mg

Ethyl (E) -3- (p-Tolyl) acrylate

Sign In for Pricing
View Details
Ethyl (E) -3- (p-Tolyl) acrylate
OR1078691-02 1 g

Ethyl (E) -3- (p-Tolyl) acrylate

Sign In for Pricing
View Details
IL4 Mouse Monoclonal Antibody [Clone ID: CC303]
AM05868RP-N 100 Tests

IL4 Mouse Monoclonal Antibody [Clone ID: CC303]

Sign In for Pricing
View Details
LOC689066 3'UTR Luciferase Stable Cell Line
TU211832 1.0 mL

LOC689066 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SLK Polyclonal Antibody, RBITC Conjugated
bs-3519R-RBITC 100 µL

SLK Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details