Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C)

This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (FITC)
MBS6398780-01 0.1 mL

XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (FITC)

Sign In for Pricing
View Details
XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (FITC)
MBS6398780-02 5x 0.1 mL

XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (FITC)

Sign In for Pricing
View Details
Multiplex Assay Kit for Thymidine Phosphorylase (TP), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0027388 96 Tests

Multiplex Assay Kit for Thymidine Phosphorylase (TP), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
DAND5/GREM3 Rabbit pAb
E47R14193 100 µL

DAND5/GREM3 Rabbit pAb

Sign In for Pricing
View Details
Binocular Biological Microscope
LX1232BMC 1 Unit

Binocular Biological Microscope

Sign In for Pricing
View Details
TBC1D19 3'UTR GFP Stable Cell Line
TU075212 1.0 mL

TBC1D19 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details