Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C)

This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal E-Selectin/CD62E Antibody (208) [Biotin]
NBP2-89432B 0.1 mL

Rabbit Monoclonal E-Selectin/CD62E Antibody (208) [Biotin]

Sign In for Pricing
View Details
FAM188B2 Protein Vector (Human) (pPM-C-HA)
19875021 500 ng

FAM188B2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM103 Antibody [PE]
NBP2-98169PE 0.1 mL

Rabbit Polyclonal TMEM103 Antibody [PE]

Sign In for Pricing
View Details
1,2-Dioleoyl-sn-glycero-3-PA ammonium
TCL-00537-01 100 mg

1,2-Dioleoyl-sn-glycero-3-PA ammonium

Sign In for Pricing
View Details
1,2-Dioleoyl-sn-glycero-3-PA ammonium
TCL-00537-02 250 mg

1,2-Dioleoyl-sn-glycero-3-PA ammonium

Sign In for Pricing
View Details
1,2-Dioleoyl-sn-glycero-3-PA ammonium
TCL-00537-03 50 mg

1,2-Dioleoyl-sn-glycero-3-PA ammonium

Sign In for Pricing
View Details