Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative chemokine-related protein B42 (CCB42)

This Recombinant Human Putative chemokine-related protein B42 (CCB42) spans the amino acid sequence from region 1-81. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative chemokine-related protein B42

UniProt

Q1T7F1

Expression Region

1-81

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPLSDWCCGICEEAPLGRAYTQTWMETGCGPHGVTALGQQELKDCLRARSGGTASSVDWIMEAARGSLNVHNCLIKFGRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NAC1 Antibody [DyLight 488]
NBP2-97154G 0.1 mL

Rabbit Polyclonal NAC1 Antibody [DyLight 488]

Sign In for Pricing
View Details
IL-8 Receptor B Antibody, Monoclonal
49-841 0.05 mg

IL-8 Receptor B Antibody, Monoclonal

Sign In for Pricing
View Details
MTHFD1 (C-1-tetrahydrofolate Synthase, Cytoplasmic, C1-THF Synthase, Methylenetetrahydrofolate Dehydrogenase, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase, MTHFC, MTHFD) (HRP)
129964-HRP 100 µL

MTHFD1 (C-1-tetrahydrofolate Synthase, Cytoplasmic, C1-THF Synthase, Methylenetetrahydrofolate Dehydrogenase, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase, MTHFC, MTHFD) (HRP)

Sign In for Pricing
View Details
EBF2 Antibody - C-terminal region : HRP (ARP37784_P050-HRP)
ARP37784_P050-HRP 100 µL

EBF2 Antibody - C-terminal region : HRP (ARP37784_P050-HRP)

Sign In for Pricing
View Details
Gm5885 (NM_001185040) Mouse Tagged Lenti ORF Clone
MR221552L3 10 µg

Gm5885 (NM_001185040) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rgl2 Rat shRNA Lentiviral Particle (Locus ID 294283)
TL713938V 500 µL Each

Rgl2 Rat shRNA Lentiviral Particle (Locus ID 294283)

Sign In for Pricing
View Details