Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1)

This Recombinant Human Testis development-related protein 1 (TDRG1) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-OAS3 Antibody Picoband®, Dylight550 Conjugate
A05032-1-Dylight550 100 µg

Anti-OAS3 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Lymphotoxin beta Receptor (Lymphotoxin B Receptor, LTbetaR, LT-beta-R, LTBR, AI256028, CD18, Ltar, TNF-R-III, Tnfbr, TNFRrp, TNFR-RP, TNFR2-RP, Tumor Necrosis Factor C Receptor, TNFCR, Tumor Necrosis Factor Receptor Superfamily Member 3, Tnfrsf3) (Biotin)
L8015-01-Biotin 100 µL

Lymphotoxin beta Receptor (Lymphotoxin B Receptor, LTbetaR, LT-beta-R, LTBR, AI256028, CD18, Ltar, TNF-R-III, Tnfbr, TNFRrp, TNFR-RP, TNFR2-RP, Tumor Necrosis Factor C Receptor, TNFCR, Tumor Necrosis Factor Receptor Superfamily Member 3, Tnfrsf3) (Biotin)

Sign In for Pricing
View Details
C7orf52 (NAT16) Human Gene Knockout Kit (CRISPR)
KN411173 1 Kit

C7orf52 (NAT16) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis Imidazolonepropionase (hutI)
MBS1458795-01 0.02 mg (E-Coli)

Recombinant Streptomyces avermitilis Imidazolonepropionase (hutI)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis Imidazolonepropionase (hutI)
MBS1458795-02 0.02 mg (Yeast)

Recombinant Streptomyces avermitilis Imidazolonepropionase (hutI)

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis Imidazolonepropionase (hutI)
MBS1458795-03 0.1 mg (E-Coli)

Recombinant Streptomyces avermitilis Imidazolonepropionase (hutI)

Sign In for Pricing
View Details