Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1)

This Recombinant Human Testis development-related protein 1 (TDRG1) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4,6-Collidine
TRC-C640040-10G 10 g

2,4,6-Collidine

Sign In for Pricing
View Details
FBP2 Polyclonal Antibody
E20-71685 100 µg

FBP2 Polyclonal Antibody

Sign In for Pricing
View Details
PPP3CC Rabbit Polyclonal Antibody
orb312603-01 50 μL

PPP3CC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP3CC Rabbit Polyclonal Antibody
orb312603-02 100 µL

PPP3CC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP3CC Rabbit Polyclonal Antibody
orb312603-03 200 µL

PPP3CC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD4a (T-cell Surface Antigen T4/Leu-3, T-cell Surface Glycoprotein CD4) (PE/Cy5) discontinued. See C2255-68D
137752 100 µg

CD4a (T-cell Surface Antigen T4/Leu-3, T-cell Surface Glycoprotein CD4) (PE/Cy5) discontinued. See C2255-68D

Sign In for Pricing
View Details