Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1)

This Recombinant Human Testis development-related protein 1 (TDRG1) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Oxo-1-phenyl-3- (2'-hydroxy-5-benzyloxyphenyl) propene
sc-209671 25 mg

3-Oxo-1-phenyl-3- (2'-hydroxy-5-benzyloxyphenyl) propene

Sign In for Pricing
View Details
PCMV-CBLL1-3xFLAG-Neo-2 Plasmid
PVT84728 2 µg

PCMV-CBLL1-3xFLAG-Neo-2 Plasmid

Sign In for Pricing
View Details
Phospho-CDC25A (Ser178) Peptide
AF3253-BP 1 mg

Phospho-CDC25A (Ser178) Peptide

Sign In for Pricing
View Details
MMP9 Rabbit mAb
AB101814 100 µL

MMP9 Rabbit mAb

Sign In for Pricing
View Details
RPL32P31 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV780025 1.0 µg DNA

RPL32P31 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
N-{[4- (Aminomethyl) phenyl]methyl}acetamide
MCA59205-01 50 mg

N-{[4- (Aminomethyl) phenyl]methyl}acetamide

Sign In for Pricing
View Details