Recombinant Human Torsin-1A-interacting protein 2, isoform IFRG15 (IFG15)
This Recombinant Human Torsin-1A-interacting protein 2, isoform IFRG15 (IFG15) spans the amino acid sequence from region 1-131. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Torsin-1A-interacting protein 2, isoform IFRG15; 15 kDa interferon-responsive protein; IFRG15; TOR1AIP2 IFRG15
UniProt
Q9H496
Expression Region
1-131
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7396607 1.0 µg DNA
Serinc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details