Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary microtubule inner protein 3 (CMIP3)

This Recombinant Human Ciliary microtubule inner protein 3 (CMIP3) spans the amino acid sequence from region 1-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ciliary microtubule inner protein 3; GUCA1A neighbor; CIMIP3 GUCA1ANB

UniProt

X6R8D5

Expression Region

1-112

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCKDSQKPSVPSHGPKTPSCKGVKAPHSSRPRAWKQDLEQSLAAAYVPVVVDSKGQNPDKLRFNFYTSQYSNSLNPFYTLQKPTCGYLYRRDTDHTRKRFDVPPANLVLWRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ZSCAN5A Antibody
CTA4984-01 30 µL

Anti-ZSCAN5A Antibody

Sign In for Pricing
View Details
Anti-ZSCAN5A Antibody
CTA4984-02 50 μL

Anti-ZSCAN5A Antibody

Sign In for Pricing
View Details
Anti-ZSCAN5A Antibody
CTA4984-03 100 µL

Anti-ZSCAN5A Antibody

Sign In for Pricing
View Details
Anti-ZSCAN5A Antibody
CTA4984-04 200 µL

Anti-ZSCAN5A Antibody

Sign In for Pricing
View Details
Ethyl (3S) -3- (4-hydroxyphenyl) hex-4-ynoate
OR1022063 1 Each

Ethyl (3S) -3- (4-hydroxyphenyl) hex-4-ynoate

Sign In for Pricing
View Details
Rabbit Anti-IP6K2 Polyclonal Antibody
PAV8301 100 μL

Rabbit Anti-IP6K2 Polyclonal Antibody

Sign In for Pricing
View Details