Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary microtubule inner protein 3 (CMIP3)

This Recombinant Human Ciliary microtubule inner protein 3 (CMIP3) spans the amino acid sequence from region 1-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ciliary microtubule inner protein 3; GUCA1A neighbor; CIMIP3 GUCA1ANB

UniProt

X6R8D5

Expression Region

1-112

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCKDSQKPSVPSHGPKTPSCKGVKAPHSSRPRAWKQDLEQSLAAAYVPVVVDSKGQNPDKLRFNFYTSQYSNSLNPFYTLQKPTCGYLYRRDTDHTRKRFDVPPANLVLWRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CyanoView II Kit (For WSE-6175)
2006276 1 Each

CyanoView II Kit (For WSE-6175)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) GLGB Polyclonal Antibody
MBS7168769 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) GLGB Polyclonal Antibody

Sign In for Pricing
View Details
Pcdha1 (NM_199503) Rat Tagged ORF Clone Lentiviral Particle
RR206097L4V 200 µL

Pcdha1 (NM_199503) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cy3 Dextran (MW 10000)
HY-D2708-01 5 mg

Cy3 Dextran (MW 10000)

Sign In for Pricing
View Details
Cy3 Dextran (MW 10000)
HY-D2708-02 10 mg

Cy3 Dextran (MW 10000)

Sign In for Pricing
View Details
Cy3 Dextran (MW 10000)
HY-D2708-03 25 mg

Cy3 Dextran (MW 10000)

Sign In for Pricing
View Details