Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Translation machinery-associated protein 7B (TMA7B)

This Recombinant Human Translation machinery-associated protein 7B (TMA7B) spans the amino acid sequence from region 1-64. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Translation machinery-associated protein 7B TMA7B

UniProt

A0A024R1R8

Expression Region

1-64

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (2H11 + 6E1), CF594 conjugate, 0.1mg/mL
BNC940724-100 1x 100 µL

Thyroglobulin (2H11 + 6E1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fblim1 (NM_001007554) Rat Tagged ORF Clone Lentiviral Particle
RR213830L4V 200 µL

Fblim1 (NM_001007554) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AGPAT2 (1-acyl-sn-glycerol-3-phosphate Acyltransferase beta, 1-acylglycerol-3-phosphate O-acyltransferase 2, 1-AGP Acyltransferase 2, 1-AGPAT 2, Lysophosphatidic Acid Acyltransferase beta, LPAAT-beta) (MaxLight 550)
123067-ML550 100 µL

AGPAT2 (1-acyl-sn-glycerol-3-phosphate Acyltransferase beta, 1-acylglycerol-3-phosphate O-acyltransferase 2, 1-AGP Acyltransferase 2, 1-AGPAT 2, Lysophosphatidic Acid Acyltransferase beta, LPAAT-beta) (MaxLight 550)

Sign In for Pricing
View Details
QUINTIX Verified Balance 210g to 0.001g
BAL7046 1 Each

QUINTIX Verified Balance 210g to 0.001g

Sign In for Pricing
View Details
GENLISA™ Human Neuronal pentraxin receptor (NPTXR) ELISA
KBH21792 1x 96 Well

GENLISA™ Human Neuronal pentraxin receptor (NPTXR) ELISA

Sign In for Pricing
View Details
Arenobufagin 3-hemisuberate
299941 5 mg

Arenobufagin 3-hemisuberate

Sign In for Pricing
View Details