Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2)

This Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CCDC28A-AS1; GVQW motif-containing protein 2; CCDC28A-AS1 GVQW2

UniProt

A0A096LPI5

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQYPFRKLLRPSTESCCVAQARVQWCHLGSLQPPLPGFKQFSCHSLPSSWDYRWNLTLSPRLECSGAISAHCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,4-Benzenetricarboxylic Acid Mixed Decyl and Octyl Triesters
B792420 250 mg

1,2,4-Benzenetricarboxylic Acid Mixed Decyl and Octyl Triesters

Sign In for Pricing
View Details
AdSS 2 (ADSS) (NM_001126) Human Tagged ORF Clone Lentiviral Particle
RC204256L1V 200 µL

AdSS 2 (ADSS) (NM_001126) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human ALG6 shRNA (UAS) - Lentiviral human ALG6 shRNA (UAS, GFP) (25)
GTR15079724 1 Vial

Lentiviral human ALG6 shRNA (UAS) - Lentiviral human ALG6 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Col4a3bp (BC016197) Mouse Tagged Lenti ORF Clone
MR206816L4 10 µg

Col4a3bp (BC016197) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Atp5g3 activation kit by CRISPRa
GA213989 1 Kit

Mouse Atp5g3 activation kit by CRISPRa

Sign In for Pricing
View Details
Insulin, Recombinant, Human (S. cerevisiae) discontinued
519064-01 2 mg

Insulin, Recombinant, Human (S. cerevisiae) discontinued

Sign In for Pricing
View Details