Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 3 (SGSN1)

This Recombinant Human Small integral membrane protein 10-like protein 3 (SGSN1) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 3; Salivary gland-specific protein SAGSIN1; SMIM10L3 SAGSIN1

UniProt

A0A0C4DGP1

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAALSGLAVRLSRSAAARSYGVFCKGLTRTLLIFFDLAWRLRINFPYLYIVASMMLNVRLQVHIEIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-500 1x 500 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF594 conjugate, 0.1mg/mL
BNC940674-100 1x 100 µL

Cytokeratin 10 (LH2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details