Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C1orf232 (CA232)

This Recombinant Human Uncharacterized protein C1orf232 (CA232) spans the amino acid sequence from region 1-186. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C1orf232 C1orf232

UniProt

A0A0U1RR37

Expression Region

1-186

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNQAFWKTYKSKVLQTLSGESEEDLAEERENPALVGSETAEPTEETFNPMSQLARRVQGVGVKGWLTMSSLFNKEDEDKLLPSEPCADHPLAARPPSQAAAAAEARGPGFWDAFASRWQQQQAAAASMLRGTEPTPEPDPEPADEAAEEAAERPESQEAEPVAGFKWGFLTHKLAEMRVKAAPKGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACADVL Human Gene Knockout Kit (CRISPR)
KN204428RB 1 Kit

ACADVL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCCC2 (NM_022132) Human Recombinant Protein
TP309488M 100 µg

MCCC2 (NM_022132) Human Recombinant Protein

Sign In for Pricing
View Details
Perfluorodecanoic Acid
TRC-P286220-25G 25 g

Perfluorodecanoic Acid

Sign In for Pricing
View Details
ABHD12 (NM_001042472) Human Over-expression Lysate
LY420926 100 µg

ABHD12 (NM_001042472) Human Over-expression Lysate

Sign In for Pricing
View Details
Superoxide Dismutase 1 (SOD1) (Antioxidant Enzyme) (SOD1/2089), CF488A conjugate, 0.1mg/mL
BNC882089-500 1x 500 µL

Superoxide Dismutase 1 (SOD1) (Antioxidant Enzyme) (SOD1/2089), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pyrophosphatase 1 Recombinant Rabbit Monoclonal Antibody [JE64-39]
HA722437 100 µL

Pyrophosphatase 1 Recombinant Rabbit Monoclonal Antibody [JE64-39]

Sign In for Pricing
View Details