Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2)

This Recombinant Human LBH domain-containing protein 2 (LBHD2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indicator Paper Wide Range (with colour scale)
01436 010Bk 10 Books

Indicator Paper Wide Range (with colour scale)

Sign In for Pricing
View Details
Papilloma Virus Type 18 (HPV 18, Early Protein E6) (APC) discontinued
171713-APC 200 µL

Papilloma Virus Type 18 (HPV 18, Early Protein E6) (APC) discontinued

Sign In for Pricing
View Details
Nmt1 (BC021635) Mouse Tagged Lenti ORF Clone
MR207956L4 10 µg

Nmt1 (BC021635) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DPH5 Protein Lysate (Mouse) with C-HA Tag
18537034 100 µg

DPH5 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
TBC1D3E sgRNA CRISPR Lentivector (Human) (Target 1)
K2338502 1.0 µg DNA

TBC1D3E sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CY24B Antibody - C-terminal region
MBS3207292-01 0.1 mL

CY24B Antibody - C-terminal region

Sign In for Pricing
View Details