Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C3orf85 (CC085)

This Recombinant Human Uncharacterized protein C3orf85 (CC085) spans the amino acid sequence from region 21-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf85 C3orf85

UniProt

A0A1B0GTC6

Expression Region

21-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APFLLEDPANQFLRLKRHVNLQDYWDPDHSSDVWVNTLAKQARETWIALKTTAQYYLDMNTFTFDMSTAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (acetyl K27) Rabbit Polyclonal Antibody (BF647)
orb1603354 100 µL

Histone H3 (acetyl K27) Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
PCDH7 Mouse Monoclonal Antibody [Clone:2G6]
E45M13189 100 µg

PCDH7 Mouse Monoclonal Antibody [Clone:2G6]

Sign In for Pricing
View Details
Sap30l 3'UTR Lenti-reporter-Luc Vector
43014086 1.0 µg

Sap30l 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FGFRL1 3'UTR Lenti-reporter-Luc Vector
20530081 1.0 µg

FGFRL1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Temsavir (BMS 626529) 10mg
A14148-10 10 mg

Temsavir (BMS 626529) 10mg

Sign In for Pricing
View Details
TMEM9 Protein Lysate (Human) with C-Ha Tag
47109031 100 µg

TMEM9 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details