Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51A (CX05A)

This Recombinant Human Uncharacterized protein CXorf51A (CX05A) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51A CXorf51A CXorf51

UniProt

A0A1B0GTR3

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Her3 (ErbB3) Antibody (Y1328)
APR00481G 0.1 mg

Polyclonal Her3 (ErbB3) Antibody (Y1328)

Sign In for Pricing
View Details
Mouse Receptor-type tyrosine-protein phosphatase F (PTPRF) ELISA Kit
RK13668 96 Tests

Mouse Receptor-type tyrosine-protein phosphatase F (PTPRF) ELISA Kit

Sign In for Pricing
View Details
CCRK (CDK20) (NM_178432) Human Tagged Lenti ORF Clone
RC214191L4 10 µg

CCRK (CDK20) (NM_178432) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Aldoc (NM_001303423) AAV Particle
MR229497A1V 250 µL

Mouse Aldoc (NM_001303423) AAV Particle

Sign In for Pricing
View Details
Vasopressin (AVP) (NM_000490) Human Tagged ORF Clone Lentiviral Particle
RC216816L4V 200 µL

Vasopressin (AVP) (NM_000490) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SENP5 (NM_152699) Human Tagged ORF Clone
RG205592 10 µg

SENP5 (NM_152699) Human Tagged ORF Clone

Sign In for Pricing
View Details