Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 5 (SPRR5)

This Recombinant Human Small proline-rich protein 5 (SPRR5) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small proline-rich protein 5 SPRR5

UniProt

A0A1B0GTR4

Expression Region

1-108

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQKQCAPPQQCCPPPQQRCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQYCPPPQQTKQPCQPPPKCQEPCAPKCPPPQQCQTSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Naegleria gruberi Translation factor GUF1 homolog, mitochondrial (NAEGRDRAFT_71680), partial
MBS1061182 Inquire

Recombinant Naegleria gruberi Translation factor GUF1 homolog, mitochondrial (NAEGRDRAFT_71680), partial

Sign In for Pricing
View Details
CEBPZ Peptide - middle region
orb2018443 100 µg

CEBPZ Peptide - middle region

Sign In for Pricing
View Details
BLVRB shRNA (h) Lentiviral Particles
sc-62021-V 200 µL

BLVRB shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Chlamydia pneumoniae (TWAR Strain) Protein
BIN106 1 mL

Chlamydia pneumoniae (TWAR Strain) Protein

Sign In for Pricing
View Details
UNC3866
S8359-100mg 100 mg

UNC3866

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Protein RecA (recA)
MBS1192591-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae Protein RecA (recA)

Sign In for Pricing
View Details