Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53)

This Recombinant Human Testis-expressed protein 53 (TEX53) spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC7 CRISPRa sgRNA lentivector (set of three targets)(Human)
18418121 3x 1.0µg DNA

DNAJC7 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mouse Zeb2 Pre-designed siRNA Set B
SI116324B 1 Each

Mouse Zeb2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Immp1l Antibody
orb1560856-01 50 µL

Immp1l Antibody

Sign In for Pricing
View Details
Immp1l Antibody
orb1560856-02 100 µL

Immp1l Antibody

Sign In for Pricing
View Details
Immp1l Antibody
orb1560856-03 200 µL

Immp1l Antibody

Sign In for Pricing
View Details
Sp1 Protein Vector (Human) (pPB-N-His)
PV039646 500 ng

Sp1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details