Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53)

This Recombinant Human Testis-expressed protein 53 (TEX53) spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Monopalmitin
BA6839-100 100 mg

1-Monopalmitin

Sign In for Pricing
View Details
Insr antibody - middle region (ARP41373_P050)
ARP41373_P050 100 µL

Insr antibody - middle region (ARP41373_P050)

Sign In for Pricing
View Details
Pan3 CRISPR/Cas9 KO Plasmid (h)
sc-405926 20 µg

Pan3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human Transgelin/TAGLN
orb1906812 50 µg

Recombinant Human Transgelin/TAGLN

Sign In for Pricing
View Details
NEDD8 Antibody (YA273, Rabbit)
HY-P80240-01 10 µL

NEDD8 Antibody (YA273, Rabbit)

Sign In for Pricing
View Details
NEDD8 Antibody (YA273, Rabbit)
HY-P80240-02 50 μL

NEDD8 Antibody (YA273, Rabbit)

Sign In for Pricing
View Details