Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53)

This Recombinant Human Testis-expressed protein 53 (TEX53) spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MPDU1 shRNA (UAS) - Lentiviral human MPDU1 shRNA (UAS, RFP) (25)
GTR15349466 1 Vial

Lentiviral human MPDU1 shRNA (UAS) - Lentiviral human MPDU1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Human IL-21 Protein
PH0030E2 20 µg

Recombinant Human IL-21 Protein

Sign In for Pricing
View Details
Anti-CDY1/2 Antibody (N143/38)
HA262013-01 50 µg

Anti-CDY1/2 Antibody (N143/38)

Sign In for Pricing
View Details
Anti-CDY1/2 Antibody (N143/38)
HA262013-02 100 µg

Anti-CDY1/2 Antibody (N143/38)

Sign In for Pricing
View Details
Anti-CDY1/2 Antibody (N143/38)
HA262013-03 1 mg

Anti-CDY1/2 Antibody (N143/38)

Sign In for Pricing
View Details
SLC39A6 Rabbit Polyclonal Antibody (PE-Cy7)
orb950823 100 µL

SLC39A6 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details