Recombinant Human Uncharacterized protein CFAP97D2 (C97D2)
This Recombinant Human Uncharacterized protein CFAP97D2 (C97D2) spans the amino acid sequence from region 1-98. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Uncharacterized protein CFAP97D2; CFAP97 domain-containing protein 2; CFAP97D2
UniProt
A0A1B0GU71
Expression Region
1-98
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MHGAPRLTFPCASEYLWHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNNSKHRRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M2825-15F-Biotin 100 µL
MDR1 (Multi Drug Resistance Protein 1, ABC20, ATP Binding Cassette Subfamily B (MDR/TAP) Member 1, ABCB1, CD243, CLCS, GP170, P-Glycoprotein, P-gp, P Glycoprotein 1, PGY1) (Biotin)
Sign In for Pricing
View Details