Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myocilin opposite strand protein (MYCOS)

This Recombinant Human Myocilin opposite strand protein (MYCOS) spans the amino acid sequence from region 1-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myocilin opposite strand protein MYOCOS

UniProt

A0A1B0GUC4

Expression Region

1-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQKSLANNSINLPYKDLTSEVTRRRVTMITRKEIITQKSDEAKEMLSHLDLEQAPPPHRTYLTVPPAPPPSPAEDPTVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMLHE Recombinant Protein (Human)
RP032314 100 µg

TMLHE Recombinant Protein (Human)

Sign In for Pricing
View Details
Nr1h5 Protein Vector (Mouse) (pPB-C-His)
PV206494 500 ng

Nr1h5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
DCXR Antibody
MBS9415241-01 0.1 mL

DCXR Antibody

Sign In for Pricing
View Details
DCXR Antibody
MBS9415241-02 5x 0.1 mL

DCXR Antibody

Sign In for Pricing
View Details
Lentiviral mouse Sec22c shRNA (UAS) - Lentiviral mouse Sec22c shRNA (UAS, RFP) plasmid
GTR15270301 1 Vial

Lentiviral mouse Sec22c shRNA (UAS) - Lentiviral mouse Sec22c shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
HLA-DQB1/2 rabbit pAb Antibody
orb767097 100 µL

HLA-DQB1/2 rabbit pAb Antibody

Sign In for Pricing
View Details