Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C10orf143 (CJ143)

This Recombinant Human Uncharacterized protein C10orf143 (CJ143) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C10orf143 C10orf143

UniProt

A0A1B0GUT2

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDSLALGRWRQRRAEDLQVPGDVKRVCRRLEASGHERGCHQVNACALASWGPEDRELPSRGCLPAPRPESGQGRLSTGISQNGGRSSAQPCPRCIAGESGHFSHTKNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM91 Antibody
A37018-50UG 50 µg

TMEM91 Antibody

Sign In for Pricing
View Details
Hepatitis A Virus Surface Antigen (HAsAg, HAV) (PE)
H1900-36-PE 100 µL

Hepatitis A Virus Surface Antigen (HAsAg, HAV) (PE)

Sign In for Pricing
View Details
MRPS31 Human shRNA Plasmid Kit (Locus ID 10240)
TL315579 1 Kit

MRPS31 Human shRNA Plasmid Kit (Locus ID 10240)

Sign In for Pricing
View Details
N-Butyl pentafluoropropionate
sc-358422A 25 g

N-Butyl pentafluoropropionate

Sign In for Pricing
View Details
CXCR6/CD186 Rabbit Monoclonal Antibody
orb1993315 100 µL

CXCR6/CD186 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Transducin alpha Antibody [Alexa Fluor 405]
NB120-3504AF405 0.1 mL

Rabbit Polyclonal Transducin alpha Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details