Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IQ domain-containing protein M (IQCM)

This Recombinant Human IQ domain-containing protein M (IQCM) spans the amino acid sequence from region 1-501. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IQ domain-containing protein M IQCM

UniProt

A0A1B0GVH7

Expression Region

1-501

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTEEAMPEKAKCPTLEITKQDFFQEAKTLIAQHYEKINENKVQGTSINVFRKKHQKPKSGKYIPLEIDKKVTRDVVQEHRAALRRICFPKELSKSEHLQEPPQRISFKEPHIFSRRERCRPIDLITKGQVKLDKIMTIIEPVSKKMETAKQQHFEESRNRMLELLYPFPVHLYLQPGTSNLELLKEPDKAFYDWRGFVLTRSFRLACDSRRVSFSQSSSIFRDYYSKTFKTLIKKERQPIKPEPKSQPRIKGTPNKTDKLDSKVKRIGPHIEIFQVFRERKKFMITPKLIRMVTVMQAHVRGWLERKRLQRVMTKALDHGPDMKAVINMYGRLIHRVRYRRGLWRTRQILNLAELEEWMDRKKFYEIMFAKREDWPKIERNELPNFFSDCGHFPTQKQVDDTWDLVHQDGKEKYSELIKKSKAIEMLFTLYPPEGAHVPDSTLLKSTWLRPIVNGEEGYRYIVNGHPALKRANIRVVGKLVARSIRERKMRQHYKSCKVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Chicken 2-Plex ELISA Kits-IL4/IL17A
GR241134 96 Well

Nori® Chicken 2-Plex ELISA Kits-IL4/IL17A

Sign In for Pricing
View Details
Rabbit Polyclonal KIF1-binding protein Antibody [Alexa Fluor 647]
NBP2-97110AF647 0.1 mL

Rabbit Polyclonal KIF1-binding protein Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
APOF Recombinant Protein
OPCD01436-50UG 50 µg

APOF Recombinant Protein

Sign In for Pricing
View Details
IL-1R2 Blocking Peptide
CBP4024-01 1 mg

IL-1R2 Blocking Peptide

Sign In for Pricing
View Details
IL-1R2 Blocking Peptide
CBP4024-02 5 mg

IL-1R2 Blocking Peptide

Sign In for Pricing
View Details
GAT1 Recombinant Antibody, RBITC Conjugated
bsm-61879R-RBITC 100 µL

GAT1 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details