Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Embryonic testis differentiation protein homolog C (ETDC)

This Recombinant Human Embryonic testis differentiation protein homolog C (ETDC) spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Embryonic testis differentiation protein homolog C ETDC

UniProt

A0A1B0GVM5

Expression Region

1-59

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDKELPKASPSEPALNIKKSGKSFKCKKPTKNVQVFLINRQLGRNRSDTDLSKWLWMLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), CF740 conjugate, 0.1mg/mL
BNC742617-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528), CF740 conjugate, 0.1mg/mL
BNC740528-100 1x 100 µL

ZAP70 (ZAP70/528), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-2 (SUMO2/1199), CF647 conjugate, 0.1mg/mL
BNC471199-500 1x 500 µL

SUMO-2 (SUMO2/1199), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (ERB2/776), CF594 conjugate, 0.1mg/mL
BNC940776-500 1x 500 µL

HER-2 / CD340 (ERB2/776), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details