Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 36 (SIM36), partial

This Recombinant Human Small integral membrane protein 36 (SIM36), partial spans the amino acid sequence from region 35-93. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 36 SMIM36

UniProt

A0A1B0GVT2

Expression Region

35-93

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDCRGKDPSKEYAPEATLEAQPSIRLVVMHPSVAGPHWPKGPGLSLGDPAPLGKKSTMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL7B (NM_001707) Human Tagged ORF Clone
RC201696 10 µg

BCL7B (NM_001707) Human Tagged ORF Clone

Sign In for Pricing
View Details
NUSAP1 Antibody - middle region : HRP (ARP46246_P050-HRP)
ARP46246_P050-HRP 100 µL

NUSAP1 Antibody - middle region : HRP (ARP46246_P050-HRP)

Sign In for Pricing
View Details
Vps53 (BC034371) Mouse Tagged ORF Clone
MG209806 10 µg

Vps53 (BC034371) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human HTR3D shRNA (UAS) - Lentiviral human HTR3D shRNA (UAS, iRFP) plasmid
GTR15100084 1 Vial

Lentiviral human HTR3D shRNA (UAS) - Lentiviral human HTR3D shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
LAMP2 (LAMP2, Lysosome-associated membrane glycoprotein 2, CD107 antigen-like family member B, CD_antigen=CD107b) (Azide free) (HRP) discontinued
031077-HRP 200 µL

LAMP2 (LAMP2, Lysosome-associated membrane glycoprotein 2, CD107 antigen-like family member B, CD_antigen=CD107b) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
AKR7A2 (Aflatoxin B1 Aldehyde Reductase Member 2, Succinic Semialdehyde Reductase, SSA Reductase, AFB1 Aldehyde Reductase 1, AFB1-AR 1, Aldoketoreductase 7, AFAR, AFAR1, AKR7) (MaxLight 490)
123177-ML490 100 µL

AKR7A2 (Aflatoxin B1 Aldehyde Reductase Member 2, Succinic Semialdehyde Reductase, SSA Reductase, AFB1 Aldehyde Reductase 1, AFB1-AR 1, Aldoketoreductase 7, AFAR, AFAR1, AKR7) (MaxLight 490)

Sign In for Pricing
View Details