Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Exocyst complex component 1-like (EXC1L)

This Recombinant Human Exocyst complex component 1-like (EXC1L) spans the amino acid sequence from region 1-172. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Exocyst complex component 1-like EXOC1L

UniProt

A0A1B0GW35

Expression Region

1-172

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSSLVKEDLEKKLFKPLSQNLYEFIEIEFSVQDRYYLCVSVTKKEEVKIVMVKHYRIGLDEKYEVTKKWSLNDLQMIDGKEADTDNPFFDLHFKKVYSLEAYSCASKYAFARTVNKLNHAYLKKDLQIVNFDSTYINDDSIWSSNNKDCLVLMRICFYAFNLVCLSLCPLPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf66 Antibody - C-terminal region
ARP47636_P050-25UL 25 µL

C21orf66 Antibody - C-terminal region

Sign In for Pricing
View Details
GHR discontinued
389521 200 µL

GHR discontinued

Sign In for Pricing
View Details
TNK1 (Non-Receptor Tyrosine-Protein Kinase TNK1, Tyrosine Kinase, Non-Receptor, 1)
494260 100 µL

TNK1 (Non-Receptor Tyrosine-Protein Kinase TNK1, Tyrosine Kinase, Non-Receptor, 1)

Sign In for Pricing
View Details
Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (GCP-05) [Alexa Fluor 488]
NBP1-45058AF488 0.1 mL

Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (GCP-05) [Alexa Fluor 488]

Sign In for Pricing
View Details
Olfr1015 Protein Vector (Mouse) (pPM-C-His)
PV207929 500 ng

Olfr1015 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Phospho-VEGF Receptor 2 (Tyr1212) (11A3) Rabbit Monoclonal Antibody
CST 2477S 100 µL

Phospho-VEGF Receptor 2 (Tyr1212) (11A3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details