Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf90 (CHO90)

This Recombinant Human Uncharacterized protein C8orf90 (CHO90) spans the amino acid sequence from region 1-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C8orf90 C8orf90

UniProt

A0A2R8Y2Y2

Expression Region

1-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASSCPGTPSPAGLPPPSVATPGETLGPAAPPEPAFPDIYGGDAQLWEAHFRGIGRAYRALGKQDDFAIRVLTENFTLPFPFAWPPGSDPACGPLFYDPRDRADFDFLLRGPGASPPALLRPLHATAQAAMRKRRLERLALSCARARGPGPASSCCCPAPPPPSRSPRPALPATAPPGWPRPRRCPESEQNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp2r5d ORF Vector (Mouse) (pORF)
37486014 1.0 µg DNA

Ppp2r5d ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Ggn shRNA (UAS) - Lentiviral mouse Ggn shRNA (UAS, GFP) (100)
GTR15278889 1 Vial

Lentiviral mouse Ggn shRNA (UAS) - Lentiviral mouse Ggn shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Taf6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7478307 1.0 µg DNA

Taf6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Erich1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4779708 1.0 µg DNA

Erich1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
DGAT2 Polyclonal Antibody, FITC Conjugated
bs-22551R-FITC 100 µL

DGAT2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Escherichia coli glpE Protein (aa 1-108) [His]
VAng-Lsx02402-50gYeast 50 µg (Yeast)

Recombinant Escherichia coli glpE Protein (aa 1-108) [His]

Sign In for Pricing
View Details