Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 41 (SIM41), partial

This Recombinant Human Small integral membrane protein 41 (SIM41), partial spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 41 SMIM41

UniProt

A0A2R8YCJ5

Expression Region

1-37

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNGSQAGAAAQAAWLSSCCNQSASPPEPPEGPRAVQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX8 (Renal Cell Marker) (PAX8/2774R), CF488A conjugate, 0.1mg/mL
BNC882774-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/2774R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DEFB135 Human Gene Knockout Kit (CRISPR)
KN424423 1 Kit

DEFB135 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Trim55 Mouse Gene Knockout Kit (CRISPR)
KN518224 1 Kit

Trim55 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glypican 5 Rabbit Polyclonal Antibody
HA500174 100 µL

Glypican 5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SERPINB3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H2]
TA506973BM 100 µL

SERPINB3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H2]

Sign In for Pricing
View Details
PCNA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]
TA804965AM 100 µL

PCNA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]

Sign In for Pricing
View Details