Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ)

This Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ) spans the amino acid sequence from region 16-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretory calcium-binding phosphoprotein proline-glutamine rich 1 SCPPPQ1

UniProt

A0A411D538

Expression Region

16-79

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPIPLEQYAESSSEQRFIFYPPQVPPFFPQVLFPLPPQPPLVLTPNDLIALLIAILNQLGILFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (ICAM3/1019), CF594 conjugate, 0.1mg/mL
BNC941019-100 1x 100 µL

CD50 (ICAM-3) (ICAM3/1019), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
BNC940012-500 1x 500 µL

Tyrosinase (T311), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adiponectin (Marker of Obesity) (ADPN/1370), CF405S conjugate, 0.1mg/mL
BNC041370-500 1x 500 µL

Adiponectin (Marker of Obesity) (ADPN/1370), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF568 conjugate, 0.1mg/mL
BNC682066-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details