Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ)

This Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ) spans the amino acid sequence from region 16-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretory calcium-binding phosphoprotein proline-glutamine rich 1 SCPPPQ1

UniProt

A0A411D538

Expression Region

16-79

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPIPLEQYAESSSEQRFIFYPPQVPPFFPQVLFPLPPQPPLVLTPNDLIALLIAILNQLGILFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Trypsin Antibody ELISA Kit
MBS053014 Inquire

Camel Trypsin Antibody ELISA Kit

Sign In for Pricing
View Details
HBP1 Protein Vector (Human) (pPB-N-His)
PV019262 500 ng

HBP1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
[IHC]TACSTD2 Rabbit Monoclonal Antibody, 1 pack = 50 µL
BAL3538 1 Each

[IHC]TACSTD2 Rabbit Monoclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details
1,3-Diethyl-1,3-diphenylurea
158731 1 g

1,3-Diethyl-1,3-diphenylurea

Sign In for Pricing
View Details
5 Lipoxygenase/ALOX5 Rabbit Polyclonal Antibody (Carrier-free)
orb3074585 100 µg

5 Lipoxygenase/ALOX5 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
FAK (Ab-861)
315601 100 µL

FAK (Ab-861)

Sign In for Pricing
View Details