Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tudor domain-containing protein 15 (TDR15), partial

This Recombinant Human Tudor domain-containing protein 15 (TDR15), partial spans the amino acid sequence from region 1011-1070. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tudor domain-containing protein 15 TDRD15

UniProt

B5MCY1

Expression Region

1011-1070

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSNKMRVCISKYVEDGLSYRALAIPTDSSSEFQVYFVDFGNKQLVGENMLRAISAQFPEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL17 Adenovirus (Rat)
20294056 1.0 mL

FBXL17 Adenovirus (Rat)

Sign In for Pricing
View Details
SERPINA6 Human Over-expression Lysate
orb1365007 20 µg

SERPINA6 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Rickettsia akari Protein MraZ (mraZ)
MBS1259668-01 0.02 mg (E-Coli)

Recombinant Rickettsia akari Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Rickettsia akari Protein MraZ (mraZ)
MBS1259668-02 0.1 mg (E-Coli)

Recombinant Rickettsia akari Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Rickettsia akari Protein MraZ (mraZ)
MBS1259668-03 0.02 mg (Yeast)

Recombinant Rickettsia akari Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Rickettsia akari Protein MraZ (mraZ)
MBS1259668-04 0.1 mg (Yeast)

Recombinant Rickettsia akari Protein MraZ (mraZ)

Sign In for Pricing
View Details