Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C5orf67 (CE067)

This Recombinant Human Uncharacterized protein C5orf67 (CE067) spans the amino acid sequence from region 1-127. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C5orf67 C5orf67

UniProt

F2Z3F1

Expression Region

1-127

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRIFYKHRKRRAPVFKEPEHGYQSLPELVLVPAQPLVCLGDYRTPDPGGLFPWSLRLMMPGAWTKLPGDGGSVPEKGKHGILGAQGQEHPGLNVSSPFSSPWTCYLSGHQPQNNNSPELQVKEILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cadherin-9 (CDH9) ELISA Kit
abx504623 96 Tests

Mouse Cadherin-9 (CDH9) ELISA Kit

Sign In for Pricing
View Details
pCMV-SPORT6-EIF1AX Plasmid
PVT33973 2 µg

pCMV-SPORT6-EIF1AX Plasmid

Sign In for Pricing
View Details
Krox-26 siRNA (h)
sc-62530 10 µM

Krox-26 siRNA (h)

Sign In for Pricing
View Details
BCL10 Knockout huh-7 Polyclonal Cells
ARG28061 1 Million

BCL10 Knockout huh-7 Polyclonal Cells

Sign In for Pricing
View Details
ABC-me shRNA Plasmid (m)
sc-41156-SH 20 µg

ABC-me shRNA Plasmid (m)

Sign In for Pricing
View Details
MAP3K3 Protein Vector (Mouse) (pPB-N-His)
PV198975 500 ng

MAP3K3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details