Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C5orf67 (CE067)

This Recombinant Human Uncharacterized protein C5orf67 (CE067) spans the amino acid sequence from region 1-127. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C5orf67 C5orf67

UniProt

F2Z3F1

Expression Region

1-127

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRIFYKHRKRRAPVFKEPEHGYQSLPELVLVPAQPLVCLGDYRTPDPGGLFPWSLRLMMPGAWTKLPGDGGSVPEKGKHGILGAQGQEHPGLNVSSPFSSPWTCYLSGHQPQNNNSPELQVKEILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MFSD3 Antibody Picoband® Fluoro550 Conjugated
A19348-2-Fluoro550 100 µg/Vial

Anti-MFSD3 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
SLCO2A1 Human Over-expression Lysate
orb1346634 100 µg

SLCO2A1 Human Over-expression Lysate

Sign In for Pricing
View Details
Human GIF siRNA
abx902149-01 15 nmol

Human GIF siRNA

Sign In for Pricing
View Details
Human GIF siRNA
abx902149-02 30 nmol

Human GIF siRNA

Sign In for Pricing
View Details
Olr1701 3'UTR Lenti-reporter-Luc Vector
34153086 1.0 µg

Olr1701 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Lentiviral human DTNBP1 shRNA (UAS) - Lentiviral human DTNBP1 shRNA (UAS, iRFP) plasmid
GTR15308023 1 Vial

Lentiviral human DTNBP1 shRNA (UAS) - Lentiviral human DTNBP1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details