Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C5orf67 (CE067)

This Recombinant Human Uncharacterized protein C5orf67 (CE067) spans the amino acid sequence from region 1-127. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C5orf67 C5orf67

UniProt

F2Z3F1

Expression Region

1-127

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRIFYKHRKRRAPVFKEPEHGYQSLPELVLVPAQPLVCLGDYRTPDPGGLFPWSLRLMMPGAWTKLPGDGGSVPEKGKHGILGAQGQEHPGLNVSSPFSSPWTCYLSGHQPQNNNSPELQVKEILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccr6 (NM_001190335) Mouse Tagged Lenti ORF Clone
MR227493L3 10 µg

Ccr6 (NM_001190335) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FMN1 Rabbit Polyclonal Antibody (FITC)
orb2095578 100 µL

FMN1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mettl11b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3904908 1.0 µg DNA

Mettl11b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Clostridium botulinum A Toxoid discontinued
226884 1 mg

Clostridium botulinum A Toxoid discontinued

Sign In for Pricing
View Details
IFluor® 633 Anti-human CD243 Antibody *UIC2*
124300E1-AAT 500 Tests

IFluor® 633 Anti-human CD243 Antibody *UIC2*

Sign In for Pricing
View Details
DDX4 Antibody
orb1326229 100 µg

DDX4 Antibody

Sign In for Pricing
View Details