Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ARL14 effector protein-like (A14EL)

This Recombinant Human ARL14 effector protein-like (A14EL) spans the amino acid sequence from region 1-152. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARL14 effector protein-like ARL14EPL

UniProt

P0DKL9

Expression Region

1-152

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNEQSEKNNSIQERHTDHSFPEKNCQIGQKQLQQIERQLKCLAFRNPGPQVADFNPETRQQKKKARMSKMNEYFSTKYKIMRKYDKSGRLICNDADLCDCLEKNCLGCFYPCPKCNSNKCGPECRCNRRWVYDAIVTESGEVISTLPFNVPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mknk2 Mouse siRNA Oligo Duplex (Locus ID 17347)
SR413678 1 Kit

Mknk2 Mouse siRNA Oligo Duplex (Locus ID 17347)

Sign In for Pricing
View Details
PTP4A1P5 Adenovirus (Human)
38132051 1.0 mL

PTP4A1P5 Adenovirus (Human)

Sign In for Pricing
View Details
Anti-IGFL4 Antibody
A18625 100 µL

Anti-IGFL4 Antibody

Sign In for Pricing
View Details
Lad Double Nickase Plasmid (m)
sc-424242-NIC 20 µg

Lad Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Fibulin-1 (FIBL-1, FIBL1, FBLN, PP213)
052833 200 µg

Fibulin-1 (FIBL-1, FIBL1, FBLN, PP213)

Sign In for Pricing
View Details
Transglutaminase 7 (TGM7) Antibody
abx210728-01 50 µL

Transglutaminase 7 (TGM7) Antibody

Sign In for Pricing
View Details