Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A)

This Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2A SMIM10L2A LINC00086 NCRNA00086

UniProt

P0DMW4

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mycobacterium tuberculosis TaqMan Probe/Primer and Control Set
TM42110 100 Reactions

Mycobacterium tuberculosis TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
PATZ1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H4]
TA809257AM 100 µL

PATZ1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H4]

Sign In for Pricing
View Details
Glycophorin C (GYPC) (NM_002101) Human Over-expression Lysate
LC419537 20 µg

Glycophorin C (GYPC) (NM_002101) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant eIF4G1 Monoclonal Antibody
AN301953L-01 50 µL

Recombinant eIF4G1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant eIF4G1 Monoclonal Antibody
AN301953L-02 100 µL

Recombinant eIF4G1 Monoclonal Antibody

Sign In for Pricing
View Details
EDG4 (LPAR2) Rabbit Polyclonal Antibody
AP05151PU-N 100 µg

EDG4 (LPAR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details