Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A)

This Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2A SMIM10L2A LINC00086 NCRNA00086

UniProt

P0DMW4

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD99, Clone PCB1 (monoclonal) Antibody
orb1087765 1 mL

Mouse CD99, Clone PCB1 (monoclonal) Antibody

Sign In for Pricing
View Details
FITC Armenian Hamster IgG Isotype Control (PIP)
FITC-30104-01 20 Tests

FITC Armenian Hamster IgG Isotype Control (PIP)

Sign In for Pricing
View Details
FITC Armenian Hamster IgG Isotype Control (PIP)
FITC-30104-02 100 Tests

FITC Armenian Hamster IgG Isotype Control (PIP)

Sign In for Pricing
View Details
FOXO1/3/4-pan Antibody
E18-6419-2 100 µg -100 µL

FOXO1/3/4-pan Antibody

Sign In for Pricing
View Details
DBN1 Peptide - middle region (AAP76078)
AAP76078-100UG 100 µg

DBN1 Peptide - middle region (AAP76078)

Sign In for Pricing
View Details
UPF2 AAV siRNA Pooled Vector
49207161 1.0 µg

UPF2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details