Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2B (SIL2B)

This Recombinant Human Small integral membrane protein 10-like protein 2B (SIL2B) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2B SMIM10L2B LINC00087 NCRNA00087

UniProt

P0DMW5

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12/DH10B) HSLU Polyclonal Antibody
MBS7184988 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) HSLU Polyclonal Antibody

Sign In for Pricing
View Details
Zebrafish LDHBA Rabbit Polyclonal Antibody (FITC)
orb3089199 100 µg

Zebrafish LDHBA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mouse Monoclonal HLA-DR Antibody (10-D8-R)
NBP3-32435 100 µL

Mouse Monoclonal HLA-DR Antibody (10-D8-R)

Sign In for Pricing
View Details
C13orf30 Antibody
C49811-01 40 µL

C13orf30 Antibody

Sign In for Pricing
View Details
C13orf30 Antibody
C49811-02 100 µL

C13orf30 Antibody

Sign In for Pricing
View Details
C13orf30 Antibody
C49811-03 200 µL

C13orf30 Antibody

Sign In for Pricing
View Details