Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 7A (LCE7A)

This Recombinant Human Late cornified envelope protein 7A (LCE7A) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 7A LCE7A

UniProt

P0DV60

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSYQKHQQKWQLPAKCLPKYPSKWTPQAPASCPAPCPPPAPSCCVSSCCISGFGGHCSLVSLRFPRFYLRQPQHSDCCEHESSRCSTCYSSGDCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHX30 AAV siRNA Pooled Vector
18198161 1.0 µg

DHX30 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Gpr61 Mouse Gene Knockout Kit (CRISPR)
KN507253 1 Kit

Gpr61 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-MCL1 Antibody (BH3 Domain Specific)
A00712-1-80ul 80 µL

Anti-MCL1 Antibody (BH3 Domain Specific)

Sign In for Pricing
View Details
Olfr67 AAV Vector (Mouse) (CMV)
63309104 1 µg

Olfr67 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Cysteine--tRNA ligase, cytoplasmic (cars), partial
MBS1307351 Inquire

Recombinant Xenopus laevis Cysteine--tRNA ligase, cytoplasmic (cars), partial

Sign In for Pricing
View Details
DRG1 Rabbit pAb
E47R20290 100 µL

DRG1 Rabbit pAb

Sign In for Pricing
View Details