Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein FAM86JP (F86JP)

This Recombinant Human Putative protein FAM86JP (F86JP) spans the amino acid sequence from region 1-40. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein FAM86JP FAM86JP

UniProt

Q05BU3

Expression Region

1-40

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPGAFSQNSSKRRAVLPRSHRVAGRGPAEAGCLPGAPAGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDZD4 CRISPR Knock Out 293T Cell Line (Human)
36352141 1x 10^6 Cells / 1.0 mL

PDZD4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ST8SIA3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
45657151 3x 1.0 µg DNA

ST8SIA3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
PBP2a, Recombinant (Penicillin-binding protein 2a) discontinued
172269 100 µg

PBP2a, Recombinant (Penicillin-binding protein 2a) discontinued

Sign In for Pricing
View Details
Human NPHP3 siRNA
abx926237-01 15 nmol

Human NPHP3 siRNA

Sign In for Pricing
View Details
Human NPHP3 siRNA
abx926237-02 30 nmol

Human NPHP3 siRNA

Sign In for Pricing
View Details
Monoclonal Antibody to Matrix Remodelling Associated Protein 5 (MXRA5)
TRV-0060667-01 20 µL

Monoclonal Antibody to Matrix Remodelling Associated Protein 5 (MXRA5)

Sign In for Pricing
View Details