Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CD300H (CD3CH), partial

This Recombinant Human Protein CD300H (CD3CH), partial spans the amino acid sequence from region 25-168. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein CD300H; CD300 antigen-like family member H; CD300H

UniProt

A0A0K2S4Q6

Expression Region

25-168

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VSGPSTVMGAVGESLSVQCRYEEKYKTFNKYWCRQPCLPIWHEMVETGGSEGVVRSDQVIITDHPGDLTFTVTLENLTADDAGKYRCGIATILQEDGLSGFLPDPFFQVQVLVSSASSTENSVKTPASPTRPSQCQGSLPSSTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bottle Top Dispenser
2061205/6 1 Each

Bottle Top Dispenser

Sign In for Pricing
View Details
2- (2-Methyl-1-naphthalenyl) -phenol
413224-01 10 mg

2- (2-Methyl-1-naphthalenyl) -phenol

Sign In for Pricing
View Details
2- (2-Methyl-1-naphthalenyl) -phenol
413224-02 25 mg

2- (2-Methyl-1-naphthalenyl) -phenol

Sign In for Pricing
View Details
Bovine A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS5) ELISA kit
CSB-EL001312BO-01 24 Well

Bovine A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS5) ELISA kit

Sign In for Pricing
View Details
Bovine A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS5) ELISA kit
CSB-EL001312BO-02 96 Well

Bovine A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS5) ELISA kit

Sign In for Pricing
View Details
Bovine A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS5) ELISA kit
CSB-EL001312BO-03 5x 96 Well

Bovine A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS5) ELISA kit

Sign In for Pricing
View Details