Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Negative regulator of P-body association (NBDY)

This Recombinant Human Negative regulator of P-body association (NBDY) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Negative regulator of P-body association; P-body dissociating protein; Protein NoBody; NBDY LINC01420

UniProt

A0A0U1RRE5

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]
TA814176BM 100 µL

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]

Sign In for Pricing
View Details
ZFYVE27 (NM_001002261) Human Over-expression Lysate
LC424194 20 µg

ZFYVE27 (NM_001002261) Human Over-expression Lysate

Sign In for Pricing
View Details
AG-1295
TRC-A425200-10MG 10 mg

AG-1295

Sign In for Pricing
View Details
OR5M8 Human Gene Knockout Kit (CRISPR)
KN424560 1 Kit

OR5M8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C4BPB (NM_000716) Human Over-expression Lysate
LC424545 20 µg

C4BPB (NM_000716) Human Over-expression Lysate

Sign In for Pricing
View Details
(Z)-13-Octadecenal
TRC-O235500-2.5MG 2.5 mg

(Z)-13-Octadecenal

Sign In for Pricing
View Details