Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dual endothelin-1/VEGF signal peptide receptor (DESPR), partial

This Recombinant Human Dual endothelin-1/VEGF signal peptide receptor (DESPR), partial spans the amino acid sequence from region 38-85. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dual endothelin-1/VEGF signal peptide receptor; DEspR protein; Dual endothelin-1/VEGFsp receptor; FBXW7 antisense RNA 1; FBXW7-AS1 DEAR DEspR

UniProt

B0L3A2

Expression Region

38-85

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KASNFSGPLQLYQRELEIFIVLTDVPNYRLIKENSHLHTTIVDQGRTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog