Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dual endothelin-1/VEGF signal peptide receptor (DESPR), partial

This Recombinant Human Dual endothelin-1/VEGF signal peptide receptor (DESPR), partial spans the amino acid sequence from region 38-85. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dual endothelin-1/VEGF signal peptide receptor; DEspR protein; Dual endothelin-1/VEGFsp receptor; FBXW7 antisense RNA 1; FBXW7-AS1 DEAR DEspR

UniProt

B0L3A2

Expression Region

38-85

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KASNFSGPLQLYQRELEIFIVLTDVPNYRLIKENSHLHTTIVDQGRTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin 19 Antibody
E11-0244C 100 µg -100 µL

Keratin 19 Antibody

Sign In for Pricing
View Details
CD54 Human Antibody (Detection) (Biotin)
orb1715992 0.1 mg

CD54 Human Antibody (Detection) (Biotin)

Sign In for Pricing
View Details
EPYC Protein Vector (Mouse) (pPB-N-His)
PV176111 500 ng

EPYC Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CRYBB2 Protein Vector (Human) (pPM-C-HA)
PV070887 500 ng

CRYBB2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CD27 (CD27 Antigen, CD27L Receptor, T-cell Activation Antigen CD27, T14, TNFRSF7, Tumor Necrosis Factor Receptor Superfamily Member 7) (HRP)
MBS6151654-01 0.1 mL

CD27 (CD27 Antigen, CD27L Receptor, T-cell Activation Antigen CD27, T14, TNFRSF7, Tumor Necrosis Factor Receptor Superfamily Member 7) (HRP)

Sign In for Pricing
View Details
CD27 (CD27 Antigen, CD27L Receptor, T-cell Activation Antigen CD27, T14, TNFRSF7, Tumor Necrosis Factor Receptor Superfamily Member 7) (HRP)
MBS6151654-02 5x 0.1 mL

CD27 (CD27 Antigen, CD27L Receptor, T-cell Activation Antigen CD27, T14, TNFRSF7, Tumor Necrosis Factor Receptor Superfamily Member 7) (HRP)

Sign In for Pricing
View Details