Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ubiquitin-related modifier 5 (SUMO5)

This Recombinant Human Small ubiquitin-related modifier 5 (SUMO5) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6; SUMO1P1 SUMO5 UBL2 UBL6

UniProt

G2XKQ0

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex I,  5nm
GM-15-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex I, 5nm

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS701096 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
GAD65 (GAD2) (NM_001134366) Human Recombinant Protein
TP325984L 1 mg

GAD65 (GAD2) (NM_001134366) Human Recombinant Protein

Sign In for Pricing
View Details
Transmembrane 4 L6 family member 1 (TM4SF1) Rabbit Polyclonal Antibody
TA371551 100 µL

Transmembrane 4 L6 family member 1 (TM4SF1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human KRTAP15-1 activation kit by CRISPRa
GA116801 1 Kit

Human KRTAP15-1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS500518 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details