Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ubiquitin-related modifier 5 (SUMO5)

This Recombinant Human Small ubiquitin-related modifier 5 (SUMO5) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6; SUMO1P1 SUMO5 UBL2 UBL6

UniProt

G2XKQ0

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), 0.2mg/mL
BNUB2587-100 1x 100 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), 0.2mg/mL

Sign In for Pricing
View Details
(3aR-cis)-Hexahydro-2-oxo-4H-furo[3,2-b]pyrrole-4-acetic Acid Ethyl Ester
TRC-H294088-25MG 25 mg

(3aR-cis)-Hexahydro-2-oxo-4H-furo[3,2-b]pyrrole-4-acetic Acid Ethyl Ester

Sign In for Pricing
View Details
CRF1 (CRHR1) (NM_001145146) Human Over-expression Lysate
LY428723 100 µg

CRF1 (CRHR1) (NM_001145146) Human Over-expression Lysate

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF740 conjugate, 0.1mg/mL
BNC742110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM218 (NM_001080546) Human Over-expression Lysate
LY421100 100 µg

TMEM218 (NM_001080546) Human Over-expression Lysate

Sign In for Pricing
View Details
Salinomycin Sodium Salt (12% min.)
TRC-S088800-1G 1 g

Salinomycin Sodium Salt (12% min.)

Sign In for Pricing
View Details